SILu^TMLite IL8, Interleukin-8 human

NA.32

SILu^™Lite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILu^™Lite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Supplied as a lyophilized powder containing phosphate buffered saline.

SILu is a trademark of sigma-aldrich Co. LLC

expressed in HEK 293 cells

200

≥95% (SDS-PAGE)

lyophilized powder

suitable for mass spectrometry (internal calibrator)

P10145

ambient

−20℃

human ... CXCL8(3576)

11 - Combustible Solids

WGK 2